Plant PC237 protein

Artikelnummer: BYT-ORB383060
Artikelname: Plant PC237 protein
Artikelnummer: BYT-ORB383060
Hersteller Artikelnummer: orb383060
Alternativnummer: BYT-ORB383060-20,BYT-ORB383060-100,BYT-ORB383060-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Glutenin, high molecular weight subunit PC237, Fragment
This Plant PC237 protein spans the amino acid sequence from region 1-39aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 31.1 kDa
UniProt: P02862
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Triticum aestivum (Wheat)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ
Anwendungsbeschreibung: Biological Origin: Triticum aestivum (Wheat). Application Notes: E.coli and Yeast N-terminal GST-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.