Plant PC237 protein

Catalog Number: BYT-ORB383060
Article Name: Plant PC237 protein
Biozol Catalog Number: BYT-ORB383060
Supplier Catalog Number: orb383060
Alternative Catalog Number: BYT-ORB383060-20,BYT-ORB383060-100,BYT-ORB383060-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Glutenin, high molecular weight subunit PC237, Fragment
This Plant PC237 protein spans the amino acid sequence from region 1-39aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.1 kDa
UniProt: P02862
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Triticum aestivum (Wheat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSASQ
Application Notes: Biological Origin: Triticum aestivum (Wheat). Application Notes: E.coli and Yeast N-terminal GST-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.