Yeast ponA protein

Artikelnummer: BYT-ORB383072
Artikelname: Yeast ponA protein
Artikelnummer: BYT-ORB383072
Hersteller Artikelnummer: orb383072
Alternativnummer: BYT-ORB383072-20,BYT-ORB383072-100,BYT-ORB383072-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ponA, DDB_G0293522, Ponticulin
This Yeast ponA protein spans the amino acid sequence from region 23-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 13.9 kDa
UniProt: P54660
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Dictyostelium discoideum (Slime mold)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS
Anwendungsbeschreibung: Biological Origin: Dictyostelium discoideum (Slime mold). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.