Yeast ponA protein

Catalog Number: BYT-ORB383072
Article Name: Yeast ponA protein
Biozol Catalog Number: BYT-ORB383072
Supplier Catalog Number: orb383072
Alternative Catalog Number: BYT-ORB383072-20,BYT-ORB383072-100,BYT-ORB383072-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ponA, DDB_G0293522, Ponticulin
This Yeast ponA protein spans the amino acid sequence from region 23-118aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 13.9 kDa
UniProt: P54660
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Dictyostelium discoideum (Slime mold)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS
Application Notes: Biological Origin: Dictyostelium discoideum (Slime mold). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.