Mouse Transthyretin protein

Artikelnummer: BYT-ORB383093
Artikelname: Mouse Transthyretin protein
Artikelnummer: BYT-ORB383093
Hersteller Artikelnummer: orb383093
Alternativnummer: BYT-ORB383093-20,BYT-ORB383093-100,BYT-ORB383093-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: anti Amyloidosis Iprotein, anti ATTRprotein, anti CTSprotein, anti CTS1protein, anti HEL111protein, anti HsT2651protein, anti PALBprotein, anti Prealbumin amyloidosis type Iprotein, anti TBPAprotein, anti Transthyretinprotein, anti TTRprotein, anti TTR proteinprotein
This Mouse Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 15.6 kDa
UniProt: P07309
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.