Mouse Transthyretin protein

Catalog Number: BYT-ORB383093
Article Name: Mouse Transthyretin protein
Biozol Catalog Number: BYT-ORB383093
Supplier Catalog Number: orb383093
Alternative Catalog Number: BYT-ORB383093-20,BYT-ORB383093-100,BYT-ORB383093-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: anti Amyloidosis Iprotein, anti ATTRprotein, anti CTSprotein, anti CTS1protein, anti HEL111protein, anti HsT2651protein, anti PALBprotein, anti Prealbumin amyloidosis type Iprotein, anti TBPAprotein, anti Transthyretinprotein, anti TTRprotein, anti TTR proteinprotein
This Mouse Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 15.6 kDa
UniProt: P07309
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.