Pig AVPR2 protein

Artikelnummer: BYT-ORB383110
Artikelname: Pig AVPR2 protein
Artikelnummer: BYT-ORB383110
Hersteller Artikelnummer: orb383110
Alternativnummer: BYT-ORB383110-20,BYT-ORB383110-100,BYT-ORB383110-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: V2R Alternative name(s), AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor
This Pig AVPR2 protein spans the amino acid sequence from region 292-370aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 24.7 kDa
UniProt: P32307
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sus scrofa (Pig)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.