Pig AVPR2 protein

Catalog Number: BYT-ORB383110
Article Name: Pig AVPR2 protein
Biozol Catalog Number: BYT-ORB383110
Supplier Catalog Number: orb383110
Alternative Catalog Number: BYT-ORB383110-20,BYT-ORB383110-100,BYT-ORB383110-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: V2R Alternative name(s), AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptor
This Pig AVPR2 protein spans the amino acid sequence from region 292-370aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 24.7 kDa
UniProt: P32307
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: WSVWDPKAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATASSFSARDTSS
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.