Plant Major pollen allergen Car b 1 isoform 2 protein

Artikelnummer: BYT-ORB383118
Artikelname: Plant Major pollen allergen Car b 1 isoform 2 protein
Artikelnummer: BYT-ORB383118
Hersteller Artikelnummer: orb383118
Alternativnummer: BYT-ORB383118-20,BYT-ORB383118-100,BYT-ORB383118-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Car b I Allergen, Car b 1
This Plant Major pollen allergen Car b 1 isoform 2 protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 19.4 kDa
UniProt: P38950
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: European hornbeam
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Anwendungsbeschreibung: Biological Origin: European hornbeam. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.