Plant Major pollen allergen Car b 1 isoform 2 protein

Catalog Number: BYT-ORB383118
Article Name: Plant Major pollen allergen Car b 1 isoform 2 protein
Biozol Catalog Number: BYT-ORB383118
Supplier Catalog Number: orb383118
Alternative Catalog Number: BYT-ORB383118-20,BYT-ORB383118-100,BYT-ORB383118-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Car b I Allergen, Car b 1
This Plant Major pollen allergen Car b 1 isoform 2 protein spans the amino acid sequence from region 2-160aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.4 kDa
UniProt: P38950
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: European hornbeam
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GVFNYEAETTSVIPAARLFKAFILDGNKLIPKVSPQAVSSVENVEGNGGPGTIKKITFSEGSPVKYVKERVEEIDHTNFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Application Notes: Biological Origin: European hornbeam. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.