Fungi hfb2 protein

Artikelnummer: BYT-ORB383131
Artikelname: Fungi hfb2 protein
Artikelnummer: BYT-ORB383131
Hersteller Artikelnummer: orb383131
Alternativnummer: BYT-ORB383131-20,BYT-ORB383131-100,BYT-ORB383131-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Hydrophobin II Short name, HFBII
This Fungi hfb2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 23.2 kDa
UniProt: P79073
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Hypocrea jecorina (Trichoderma reesei)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Anwendungsbeschreibung: Biological Origin: Hypocrea jecorina (Trichoderma reesei). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.