Fungi hfb2 protein

Catalog Number: BYT-ORB383131
Article Name: Fungi hfb2 protein
Biozol Catalog Number: BYT-ORB383131
Supplier Catalog Number: orb383131
Alternative Catalog Number: BYT-ORB383131-20,BYT-ORB383131-100,BYT-ORB383131-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Hydrophobin II Short name, HFBII
This Fungi hfb2 protein spans the amino acid sequence from region 16-86aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 23.2 kDa
UniProt: P79073
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Hypocrea jecorina (Trichoderma reesei)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Application Notes: Biological Origin: Hypocrea jecorina (Trichoderma reesei). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.