Mouse Clec4e protein

Artikelnummer: BYT-ORB383132
Artikelname: Mouse Clec4e protein
Artikelnummer: BYT-ORB383132
Hersteller Artikelnummer: orb383132
Alternativnummer: BYT-ORB383132-20,BYT-ORB383132-100,BYT-ORB383132-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: C-type lectin superfamily member 9 Macrophage-inducible C-type lectin
This Mouse Clec4e protein spans the amino acid sequence from region 46-214aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 23.6 kDa
UniProt: Q9R0Q8
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.