Mouse Clec4e protein

Catalog Number: BYT-ORB383132
Article Name: Mouse Clec4e protein
Biozol Catalog Number: BYT-ORB383132
Supplier Catalog Number: orb383132
Alternative Catalog Number: BYT-ORB383132-20,BYT-ORB383132-100,BYT-ORB383132-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: C-type lectin superfamily member 9 Macrophage-inducible C-type lectin
This Mouse Clec4e protein spans the amino acid sequence from region 46-214aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 23.6 kDa
UniProt: Q9R0Q8
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.