Human NAT2 protein

Artikelnummer: BYT-ORB383140
Artikelname: Human NAT2 protein
Artikelnummer: BYT-ORB383140
Hersteller Artikelnummer: orb383140
Alternativnummer: BYT-ORB383140-20,BYT-ORB383140-100,BYT-ORB383140-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Arylamide acetylase 2 N-acetyltransferase type 2 Short name, NAT-2 Polymorphic arylamine N-acetyltransferase Short name, PNAT
This Human NAT2 protein spans the amino acid sequence from region 1-290aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 49.5 kDa
UniProt: P11245
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.