Human NAT2 protein

Catalog Number: BYT-ORB383140
Article Name: Human NAT2 protein
Biozol Catalog Number: BYT-ORB383140
Supplier Catalog Number: orb383140
Alternative Catalog Number: BYT-ORB383140-20,BYT-ORB383140-100,BYT-ORB383140-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Arylamide acetylase 2 N-acetyltransferase type 2 Short name, NAT-2 Polymorphic arylamine N-acetyltransferase Short name, PNAT
This Human NAT2 protein spans the amino acid sequence from region 1-290aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 49.5 kDa
UniProt: P11245
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.