Bacterial hns protein
Artikelnummer:
BYT-ORB383205
- Bilder (3)
| Artikelname: | Bacterial hns protein |
| Artikelnummer: | BYT-ORB383205 |
| Hersteller Artikelnummer: | orb383205 |
| Alternativnummer: | BYT-ORB383205-20,BYT-ORB383205-100,BYT-ORB383205-1 |
| Hersteller: | Biorbyt |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Histone-like protein HLP-II |
| This Bacterial hns protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molekulargewicht: | 19.5 kDa |
| UniProt: | P18955 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Serratia marcescens |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL |
| Anwendungsbeschreibung: | Biological Origin: Serratia marcescens. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Serratia marcescenshns. |
|
|
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Serratia marcescenshns. |
Produktgarantie und fachkundiger Support
