Bacterial hns protein

Catalog Number: BYT-ORB383205
Article Name: Bacterial hns protein
Biozol Catalog Number: BYT-ORB383205
Supplier Catalog Number: orb383205
Alternative Catalog Number: BYT-ORB383205-20,BYT-ORB383205-100,BYT-ORB383205-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Histone-like protein HLP-II
This Bacterial hns protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 19.5 kDa
UniProt: P18955
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Serratia marcescens
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Application Notes: Biological Origin: Serratia marcescens. Application Notes: E.coli and Yeast N-terminal 6xHis-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Serratia marcescenshns.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Serratia marcescenshns.