Plant LOLPIB protein

Artikelnummer: BYT-ORB383358
Artikelname: Plant LOLPIB protein
Artikelnummer: BYT-ORB383358
Hersteller Artikelnummer: orb383358
Alternativnummer: BYT-ORB383358-20,BYT-ORB383358-100,BYT-ORB383358-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Allergen Lol p Ib Allergen Lol p Va Allergen, Lol p 5a
This Plant LOLPIB protein spans the amino acid sequence from region 26-307aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 48.4 kDa
UniProt: Q40240
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Lolium perenne
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVA
Anwendungsbeschreibung: Biological Origin: Lolium perenne. Application Notes: E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.