Plant LOLPIB protein

Catalog Number: BYT-ORB383358
Article Name: Plant LOLPIB protein
Biozol Catalog Number: BYT-ORB383358
Supplier Catalog Number: orb383358
Alternative Catalog Number: BYT-ORB383358-20,BYT-ORB383358-100,BYT-ORB383358-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Allergen Lol p Ib Allergen Lol p Va Allergen, Lol p 5a
This Plant LOLPIB protein spans the amino acid sequence from region 26-307aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 48.4 kDa
UniProt: Q40240
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Lolium perenne
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ADAGYTPAAAATPATPAATPAAAGGKATTDEQKLLEDVNAGFKAAVAAAANAPPADKFKIFEAAFSESSKGLLATSAAKAPGLIPKLDTAYDVAYKAAEATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVLAAKIPTGELQIVDKIDAAFKIAATAANAAPTNDKFTVFESAFNKALNECTGGAYETYKFIPSLEAAVKQAYAATVAAAPEVKYAVFEAALTKAITAMTQAQKAGKPAAAAATAAATVA
Application Notes: Biological Origin: Lolium perenne. Application Notes: E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.