Mouse OSM34 protein

Artikelnummer: BYT-ORB383366
Artikelname: Mouse OSM34 protein
Artikelnummer: BYT-ORB383366
Hersteller Artikelnummer: orb383366
Alternativnummer: BYT-ORB383366-20,BYT-ORB383366-100,BYT-ORB383366-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: OSL3_ARATH, OSM34, Osmotin-like protein OSM34
This Mouse OSM34 protein spans the amino acid sequence from region 23-244aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 44.4 kDa
UniProt: P50700
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Arabidopsis thaliana (Mouse-ear cress)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN
Anwendungsbeschreibung: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.