Mouse OSM34 protein

Catalog Number: BYT-ORB383366
Article Name: Mouse OSM34 protein
Biozol Catalog Number: BYT-ORB383366
Supplier Catalog Number: orb383366
Alternative Catalog Number: BYT-ORB383366-20,BYT-ORB383366-100,BYT-ORB383366-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: OSL3_ARATH, OSM34, Osmotin-like protein OSM34
This Mouse OSM34 protein spans the amino acid sequence from region 23-244aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 44.4 kDa
UniProt: P50700
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Arabidopsis thaliana (Mouse-ear cress)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ATFEILNQCSYTVWAAASPGGGRRLDAGQSWRLDVAAGTKMARIWGRTNCNFDSSGRGRCQTGDCSGGLQCTGWGQPPNTLAEYALNQFNNLDFYDISLVDGFNIPMEFSPTSSNCHRILCTADINGQCPNVLRAPGGCNNPCTVFQTNQYCCTNGQGSCSDTEYSRFFKQRCPDAYSYPQDDPTSTFTCTNTNYRVVFCPRSRLGATGSHQLPIKMVTEEN
Application Notes: Biological Origin: Arabidopsis thaliana (Mouse-ear cress). Application Notes: E.coli and Yeast N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Full Length of Isoform 2
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.