E. coli mcr1 protein

Artikelnummer: BYT-ORB383384
Artikelname: E. coli mcr1 protein
Artikelnummer: BYT-ORB383384
Hersteller Artikelnummer: orb383384
Alternativnummer: BYT-ORB383384-20,BYT-ORB383384-100,BYT-ORB383384-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Polymyxin resistance protein MCR-1
This E. coli mcr1 protein spans the amino acid sequence from region 1-541aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 76.1 kDa
UniProt: A0A0R6L508
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MMQHTSVWYRRSVSPFVLVASVAVFLTATANLTFFDKISQTYPIADNLGFVLTIAVVLFGAMLLITTLLSSYRYVLKPVLILLLIMGAVTSYFTDTYGTVYDTTMLQNALQTDQAETKDLLNAAFIMRIIGLGVLPSLLVAFVKVDYPTWGKGLMRRLGLIVASLALILLPVVAFSSHYASFFRVHKPLRSYVNPIMPIYSVGKLASIEYKKASAPKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSF
Anwendungsbeschreibung: Biological Origin: Escherichia coli. Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.