E. coli mcr1 protein

Catalog Number: BYT-ORB383384
Article Name: E. coli mcr1 protein
Biozol Catalog Number: BYT-ORB383384
Supplier Catalog Number: orb383384
Alternative Catalog Number: BYT-ORB383384-20,BYT-ORB383384-100,BYT-ORB383384-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Polymyxin resistance protein MCR-1
This E. coli mcr1 protein spans the amino acid sequence from region 1-541aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 76.1 kDa
UniProt: A0A0R6L508
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MMQHTSVWYRRSVSPFVLVASVAVFLTATANLTFFDKISQTYPIADNLGFVLTIAVVLFGAMLLITTLLSSYRYVLKPVLILLLIMGAVTSYFTDTYGTVYDTTMLQNALQTDQAETKDLLNAAFIMRIIGLGVLPSLLVAFVKVDYPTWGKGLMRRLGLIVASLALILLPVVAFSSHYASFFRVHKPLRSYVNPIMPIYSVGKLASIEYKKASAPKDTIYHAKDAVQATKPDMRKPRLVVFVVGETARADHVSF
Application Notes: Biological Origin: Escherichia coli. Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.