E. coli fimA protein

Artikelnummer: BYT-ORB383395
Artikelname: E. coli fimA protein
Artikelnummer: BYT-ORB383395
Hersteller Artikelnummer: orb383395
Alternativnummer: BYT-ORB383395-20,BYT-ORB383395-100,BYT-ORB383395-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Type-1A pilin
This E. coli fimA protein spans the amino acid sequence from region 24-182aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 31.8 kDa
UniProt: P04128
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.