E. coli fimA protein

Catalog Number: BYT-ORB383395
Article Name: E. coli fimA protein
Biozol Catalog Number: BYT-ORB383395
Supplier Catalog Number: orb383395
Alternative Catalog Number: BYT-ORB383395-20,BYT-ORB383395-100,BYT-ORB383395-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Type-1A pilin
This E. coli fimA protein spans the amino acid sequence from region 24-182aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.8 kDa
UniProt: P04128
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AATTVNGGTVHFKGEVVNAACAVDAGSVDQTVQLGQVRTASLAQEGATSSAVGFNIQLNDCDTNVASKAAVAFLGTAIDAGHTNVLALQSSAAGSATNVGVQILDRTGAALTLDGATFSSETTLNNGTNTIPFQARYFATGAATPGAANADATFKVQYQ
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.