Bacterial emm5 protein

Artikelnummer: BYT-ORB383408
Artikelname: Bacterial emm5 protein
Artikelnummer: BYT-ORB383408
Hersteller Artikelnummer: orb383408
Alternativnummer: BYT-ORB383408-20,BYT-ORB383408-100,BYT-ORB383408-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: emm5, smp5M protein, serotype 5
This Bacterial emm5 protein spans the amino acid sequence from region 43-461aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 52.5 kDa
UniProt: P02977
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Streptococcus pyogenes serotype M5
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: AVTRGTINDPQRAKEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLSTQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQELANKQQESKENEKALNELLEKTVKDKIAKEQENKETIGTLKKILDETVKDKIAKEQENKETIGTLKKILDETVKDKLAKEQKSKQNIGALKQELAKKDEANKISDASRKGLRRDLDASREAKKQLEAEHQKLEEQNKISEA
Anwendungsbeschreibung: Biological Origin: Streptococcus pyogenes serotype M5. Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.