Bacterial emm5 protein

Catalog Number: BYT-ORB383408
Article Name: Bacterial emm5 protein
Biozol Catalog Number: BYT-ORB383408
Supplier Catalog Number: orb383408
Alternative Catalog Number: BYT-ORB383408-20,BYT-ORB383408-100,BYT-ORB383408-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: emm5, smp5M protein, serotype 5
This Bacterial emm5 protein spans the amino acid sequence from region 43-461aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 52.5 kDa
UniProt: P02977
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Streptococcus pyogenes serotype M5
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AVTRGTINDPQRAKEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLSTQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQELANKQQESKENEKALNELLEKTVKDKIAKEQENKETIGTLKKILDETVKDKIAKEQENKETIGTLKKILDETVKDKLAKEQKSKQNIGALKQELAKKDEANKISDASRKGLRRDLDASREAKKQLEAEHQKLEEQNKISEA
Application Notes: Biological Origin: Streptococcus pyogenes serotype M5. Application Notes: E.coli and Yeast N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.