Pig IL4R protein

Artikelnummer: BYT-ORB418692
Artikelname: Pig IL4R protein
Artikelnummer: BYT-ORB418692
Hersteller Artikelnummer: orb418692
Alternativnummer: BYT-ORB418692-20,BYT-ORB418692-100,BYT-ORB418692-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CD_antigen, CD124
This Pig IL4R protein spans the amino acid sequence from region 33-240aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 28.2 kDa
UniProt: Q863Z5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sus scrofa (Pig)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 33-240aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.