Pig IL4R protein

Catalog Number: BYT-ORB418692
Article Name: Pig IL4R protein
Biozol Catalog Number: BYT-ORB418692
Supplier Catalog Number: orb418692
Alternative Catalog Number: BYT-ORB418692-20,BYT-ORB418692-100,BYT-ORB418692-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD_antigen, CD124
This Pig IL4R protein spans the amino acid sequence from region 33-240aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 28.2 kDa
UniProt: Q863Z5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: Tag Info: N-terminal 6xHis-taggedExpression Region: 33-240aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.