Human ENGASE protein

Artikelnummer: BYT-ORB418694
Artikelname: Human ENGASE protein
Artikelnummer: BYT-ORB418694
Hersteller Artikelnummer: orb418694
Alternativnummer: BYT-ORB418694-20,BYT-ORB418694-100,BYT-ORB418694-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cytosolic endo-beta-N-acetylglucosaminidase, DKFZp434P174, ENASE_HUMAN, ENGase, FLJ21865, Mannosyl glycoprotein endo beta N acetylglucosaminidase
This Human ENGASE protein spans the amino acid sequence from region 1-377aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 59.1 kDa
UniProt: Q8NFI3
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-377aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.



* Mehrwertsteuer und Versandkosten nicht enthalten.
Irrtümer und Preisänderungen vorbehalten
Verfügbarkeit
PER E-MAIL BESTELLEN
Produktgarantie und fachkundiger Support
BIOZOL