Human ENGASE protein

Catalog Number: BYT-ORB418694
Article Name: Human ENGASE protein
Biozol Catalog Number: BYT-ORB418694
Supplier Catalog Number: orb418694
Alternative Catalog Number: BYT-ORB418694-20,BYT-ORB418694-100,BYT-ORB418694-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cytosolic endo-beta-N-acetylglucosaminidase, DKFZp434P174, ENASE_HUMAN, ENGase, FLJ21865, Mannosyl glycoprotein endo beta N acetylglucosaminidase
This Human ENGASE protein spans the amino acid sequence from region 1-377aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 59.1 kDa
UniProt: Q8NFI3
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MEAAAVTVTRSATRRRRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSFSPDPLPVRYYDKDTTKPISFYLSSLEELLAWKPRLEDGFNVALEPLACRQPPLSSQRPRTLLCHDMMGGYLDDRFIQGSVVQTPYAFYHWQCIDVFVYFSHHTVTIPPVGWTNTAHRHGVCVLGTFITEWNEGGRLCEAFLAGDERSYQAVADRLVQITQFFRFDGWLINIENSLSLAAVGNMPPFLRYL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 1-377aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.