E. coli msyB protein

Artikelnummer: BYT-ORB418701
Artikelname: E. coli msyB protein
Artikelnummer: BYT-ORB418701
Hersteller Artikelnummer: orb418701
Alternativnummer: BYT-ORB418701-20,BYT-ORB418701-100,BYT-ORB418701-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: msyB, b1051, JW1039, Acidic protein MsyB
This E. coli msyB protein spans the amino acid sequence from region 1-124aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molekulargewicht: 16.3 kDa
UniProt: P25738
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Escherichia coli (strain K12)
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Anwendungsbeschreibung: Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: C-terminal 6xHis-taggedExpression Region: 1-124aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.