E. coli msyB protein

Catalog Number: BYT-ORB418701
Article Name: E. coli msyB protein
Biozol Catalog Number: BYT-ORB418701
Supplier Catalog Number: orb418701
Alternative Catalog Number: BYT-ORB418701-20,BYT-ORB418701-100,BYT-ORB418701-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: msyB, b1051, JW1039, Acidic protein MsyB
This E. coli msyB protein spans the amino acid sequence from region 1-124aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 16.3 kDa
UniProt: P25738
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTMYATLEEAIDAAREEFLADNPGIDAEDANVQQFNAQKYVLQDGDIMWQVEFFADEGEEGECLPMLSGEAAQSVFDGDYDEIEIRQEWQEENTLHEWDEGEFQLEPPLDTEEGRAAADEWDER
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Tag Info: C-terminal 6xHis-taggedExpression Region: 1-124aaSequence Info: Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.