Viral LMP2 protein

Artikelnummer: BYT-ORB54194
Artikelname: Viral LMP2 protein
Artikelnummer: BYT-ORB54194
Hersteller Artikelnummer: orb54194
Alternativnummer: BYT-ORB54194-20,BYT-ORB54194-100,BYT-ORB54194-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Terminal protein
This Viral LMP2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 17.6 kDa
UniProt: P13285
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS
Anwendungsbeschreibung: Biological Origin: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-tagged1-331AA: 1-147AAFull Length: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) LMP2.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) LMP2.