Viral LMP2 protein
Catalog Number:
BYT-ORB54194
- Images (3)
| Article Name: | Viral LMP2 protein |
| Biozol Catalog Number: | BYT-ORB54194 |
| Supplier Catalog Number: | orb54194 |
| Alternative Catalog Number: | BYT-ORB54194-20,BYT-ORB54194-100,BYT-ORB54194-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Terminal protein |
| This Viral LMP2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 17.6 kDa |
| UniProt: | P13285 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS |
| Application Notes: | Biological Origin: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-tagged1-331AA: 1-147AAFull Length: Partial |
|
|
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) LMP2. |
|
|
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) LMP2. |
Product Guarantee and Expert Support
