Human REXO4 protein

Artikelnummer: BYT-ORB54716
Artikelname: Human REXO4 protein
Artikelnummer: BYT-ORB54716
Hersteller Artikelnummer: orb54716
Alternativnummer: BYT-ORB54716-20,BYT-ORB54716-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Exonuclease XPMC2 Prevents mitotic catastrophe 2 protein homolog Short name, hPMC2
This Human REXO4 protein spans the amino acid sequence from region 1-422aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 62.7 kDa
UniProt: Q9GZR2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged29-760AA: 1-422AAExtracellular Domain: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.