Human REXO4 protein

Catalog Number: BYT-ORB54716
Article Name: Human REXO4 protein
Biozol Catalog Number: BYT-ORB54716
Supplier Catalog Number: orb54716
Alternative Catalog Number: BYT-ORB54716-20,BYT-ORB54716-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Exonuclease XPMC2 Prevents mitotic catastrophe 2 protein homolog Short name, hPMC2
This Human REXO4 protein spans the amino acid sequence from region 1-422aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 62.7 kDa
UniProt: Q9GZR2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKKRFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIEHKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEMVGVGP
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-SUMO-tagged: N-terminal 6xHis-SUMO-tagged29-760AA: 1-422AAExtracellular Domain: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.