Human SFTPA1 protein

Artikelnummer: BYT-ORB54726
Artikelname: Human SFTPA1 protein
Artikelnummer: BYT-ORB54726
Hersteller Artikelnummer: orb54726
Alternativnummer: BYT-ORB54726-20,BYT-ORB54726-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Collectin-4
This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 41.2 kDa
UniProt: Q8IWL2
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged106-222AA: 21-248AAPartial: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.