Human SFTPA1 protein

Catalog Number: BYT-ORB54726
Article Name: Human SFTPA1 protein
Biozol Catalog Number: BYT-ORB54726
Supplier Catalog Number: orb54726
Alternative Catalog Number: BYT-ORB54726-20,BYT-ORB54726-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Collectin-4
This Human SFTPA1 protein spans the amino acid sequence from region 21-248aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 41.2 kDa
UniProt: Q8IWL2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPMGPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged106-222AA: 21-248AAPartial: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.