Mouse Cbln3 protein

Artikelnummer: BYT-ORB54728
Artikelname: Mouse Cbln3 protein
Artikelnummer: BYT-ORB54728
Hersteller Artikelnummer: orb54728
Alternativnummer: BYT-ORB54728-20,BYT-ORB54728-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cbln3Cerebellin-3
This Mouse Cbln3 protein spans the amino acid sequence from region 25-197aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 22.4 kDa
UniProt: Q9JHG0
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged: N-terminal 6xHis-SUMO-tagged21-248AA: 25-197AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.