Mouse Cbln3 protein

Catalog Number: BYT-ORB54728
Article Name: Mouse Cbln3 protein
Biozol Catalog Number: BYT-ORB54728
Supplier Catalog Number: orb54728
Alternative Catalog Number: BYT-ORB54728-20,BYT-ORB54728-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cbln3Cerebellin-3
This Mouse Cbln3 protein spans the amino acid sequence from region 25-197aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 22.4 kDa
UniProt: Q9JHG0
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QEGSEPVLLEGECLVVCEPGRPTAGGPGGAALGEAPPGRVAFAAVRSHHHEPAGETGNGTSGAIYFDQVLVNEGEGFDRTSGCFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREAATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSSFSGFLIFPL
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged: N-terminal 6xHis-SUMO-tagged21-248AA: 25-197AAFull Length : Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.