Pig TCN1 protein

Artikelnummer: BYT-ORB54748
Artikelname: Pig TCN1 protein
Artikelnummer: BYT-ORB54748
Hersteller Artikelnummer: orb54748
Alternativnummer: BYT-ORB54748-20,BYT-ORB54748-100
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Cobalophilin Haptocorrin Protein R Transcobalamin I
This Pig TCN1 protein spans the amino acid sequence from region 25-416aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 48.3 kDa
UniProt: P17630
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Sus scrofa (Pig)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFR
Anwendungsbeschreibung: Biological Origin: Sus scrofa (Pig). Application Notes: N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged1-757AA: 25-416AAFull Length : Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.