Pig TCN1 protein

Catalog Number: BYT-ORB54748
Article Name: Pig TCN1 protein
Biozol Catalog Number: BYT-ORB54748
Supplier Catalog Number: orb54748
Alternative Catalog Number: BYT-ORB54748-20,BYT-ORB54748-100
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Cobalophilin Haptocorrin Protein R Transcobalamin I
This Pig TCN1 protein spans the amino acid sequence from region 25-416aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 48.3 kDa
UniProt: P17630
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Sus scrofa (Pig)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFR
Application Notes: Biological Origin: Sus scrofa (Pig). Application Notes: N-terminal 10xHis-tagged and C-terminal Myc-tagged: N-terminal 6xHis-tagged1-757AA: 25-416AAFull Length : Full Length of Mature Protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.