Human CCNB1 protein

Artikelnummer: BYT-ORB54755
Artikelname: Human CCNB1 protein
Artikelnummer: BYT-ORB54755
Hersteller Artikelnummer: orb54755
Alternativnummer: BYT-ORB54755-20,BYT-ORB54755-100,BYT-ORB54755-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: CCNB 1, CCNB, ccnb1, CCNB1_HUMAN, Cyclin B1, G2 mitotic specific cyclin B1 , G2/mitotic-specific cyclin-B1
This Human CCNB1 protein spans the amino acid sequence from region 1-433aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 52.3 kDa
UniProt: P14635
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIA
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged24-370AA: 1-433AAFull Length of Mature Protein: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.