Human CCNB1 protein

Catalog Number: BYT-ORB54755
Article Name: Human CCNB1 protein
Biozol Catalog Number: BYT-ORB54755
Supplier Catalog Number: orb54755
Alternative Catalog Number: BYT-ORB54755-20,BYT-ORB54755-100,BYT-ORB54755-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CCNB 1, CCNB, ccnb1, CCNB1_HUMAN, Cyclin B1, G2 mitotic specific cyclin B1 , G2/mitotic-specific cyclin-B1
This Human CCNB1 protein spans the amino acid sequence from region 1-433aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 52.3 kDa
UniProt: P14635
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIA
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: N-terminal 6xHis-tagged: N-terminal 10xHis-tagged and C-terminal Myc-tagged24-370AA: 1-433AAFull Length of Mature Protein: Full Length
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.