ESR2 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB573884
Artikelname: ESR2 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB573884
Hersteller Artikelnummer: orb573884
Alternativnummer: BYT-ORB573884-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ESR2
Konjugation: Unconjugated
Alternative Synonym: Erb, ESRB, ODG8, ESTRB, NR3A2, ER-BETA, ESR-BETA
Rabbit polyclonal antibody to Estrogen Receptor beta
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 48kDa
UniProt: Q92731
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: TPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGN
Target-Kategorie: ESR2