ESR2 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB573884
Article Name: ESR2 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB573884
Supplier Catalog Number: orb573884
Alternative Catalog Number: BYT-ORB573884-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ESR2
Conjugation: Unconjugated
Alternative Names: Erb, ESRB, ODG8, ESTRB, NR3A2, ER-BETA, ESR-BETA
Rabbit polyclonal antibody to Estrogen Receptor beta
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 48kDa
UniProt: Q92731
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: TPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGN
Target: ESR2