CITED1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB574346
- Bilder (7)
| Artikelname: | CITED1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: | BYT-ORB574346 |
| Hersteller Artikelnummer: | orb574346 |
| Alternativnummer: | BYT-ORB574346-100 |
| Hersteller: | Biorbyt |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human CITED1 |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MSG1 |
| Rabbit polyclonal antibody to CITED1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Molekulargewicht: | 23 kDa |
| NCBI: | 004134 |
| UniProt: | Q99966 |
| Puffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: | Synthetic peptide located within the following region: IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEA |
| Target-Kategorie: | CITED1 |
|
|
Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml. |
|
|
Sample Tissue: Human MKN45 Whole Cell, Antibody dilution: 5 ug/ml. |
|
|
Human kidney |
|
|
Human Lung |
|
|
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown. |
|
|
WB Suggested Anti-CITED1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. |
|
|
WB Suggested Anti-CITED1 antibody Titration: 1 ug/ml, Sample Type: Human HepG2. |
Produktgarantie und fachkundiger Support
