CITED1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB574346
Article Name: CITED1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB574346
Supplier Catalog Number: orb574346
Alternative Catalog Number: BYT-ORB574346-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CITED1
Conjugation: Unconjugated
Alternative Names: MSG1
Rabbit polyclonal antibody to CITED1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 23 kDa
NCBI: 004134
UniProt: Q99966
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEA
Target: CITED1
Sample Tissue: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.
Sample Tissue: Human MKN45 Whole Cell, Antibody dilution: 5 ug/ml.
Human kidney
Human Lung
Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
WB Suggested Anti-CITED1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
WB Suggested Anti-CITED1 antibody Titration: 1 ug/ml, Sample Type: Human HepG2.